PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c9_15975V3.3.p
Common NamePHYPADRAFT_184923
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 422aa    MW: 46538.5 Da    PI: 7.126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c9_15975V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT eEd++lv +++  G g+W++ ++  g+ R++k+c++rw +yl
  Pp3c9_15975V3.3.p 14 RGPWTVEEDQKLVSYITNNGLGCWRATPKLAGLLRCGKSCRLRWINYL 61
                       89******************************99************97 PP

2Myb_DNA-binding53.36.3e-1767110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg +++eE+ l++da++ lG++ W++Ia+ ++ gRt++++k++w++
  Pp3c9_15975V3.3.p  67 RGIFSEEEENLILDAHATLGNR-WSRIAAQLP-GRTDNEIKNYWNT 110
                        6889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.22961IPR017930Myb domain
SuperFamilySSF466895.62E-2711108IPR009057Homeodomain-like
SMARTSM007172.3E-91363IPR001005SANT/Myb domain
PfamPF002492.2E-121461IPR001005SANT/Myb domain
CDDcd001677.12E-81661No hitNo description
PROSITE profilePS5129425.45362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2665116IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.1E-1567110IPR001005SANT/Myb domain
CDDcd001671.09E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRKPCCEKA GLKRGPWTVE EDQKLVSYIT NNGLGCWRAT PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGIF SEEEENLILD AHATLGNRWS RIAAQLPGRT DNEIKNYWNT RLKKRLRSQG  120
LDPNTHLPLR TDRSDGTGGD TDVEDGDCSD ATMSDATKSK IKVKRKAKFQ ETVKVRQPKG  180
PKPAPQLKMC QSEEGPVLLK VSKCPQSSTR INPSRARNFD DDSEHSSSSP ASSTITTKSA  240
EDHQDSSSFV RSLTSAPSFP EAELWNCIKP STNSITTGAL LSDWDSNRGL DSSLPCPYLH  300
SNTEPPKLEE CKPLVTPPLT QGVSPSHDTM DIGMQRNMHV SSQPSLEVGE NYCSIFQGTC  360
FPQLEMDMSW TMEGEISHAT PEPIFALAPP ISAGLYGEVL PPAPRDSSQE MQRLAALLDL  420
I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110116RLKKRLR
2111117LKKRLRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.49480.0gametophore| protonema| sporophyte
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001765703.10.0predicted protein
SwissprotP800731e-176MYB2_PHYPA; Myb-related protein Pp2
TrEMBLA9SH570.0A9SH57_PHYPA; Predicted protein
STRINGPP1S78_152V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.12e-67myb domain protein 43
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]